PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00063.1_g00025.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 334aa    MW: 37520.6 Da    PI: 5.9044
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00063.1_g00025.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd +l+ +v+++G g W+t + + g++R++k+c++rw +yl
  Rsa1.0_00063.1_g00025.1 14 KGAWTQEEDHKLIAYVERHGEGGWRTLPDKAGLKRCGKSCRLRWANYL 61
                             79********************************************97 PP

2Myb_DNA-binding58.21.8e-1867111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg +++eE++ +v++++ +G++ W++Iar+++ gRt++++k++w+++
  Rsa1.0_00063.1_g00025.1  67 RGEFSQEEEDSIVRLHAIHGNK-WSAIARRLP-GRTDNEIKNHWNTH 111
                              899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.132961IPR017930Myb domain
SuperFamilySSF466891.2E-2911108IPR009057Homeodomain-like
SMARTSM007176.8E-121363IPR001005SANT/Myb domain
PfamPF002491.3E-151461IPR001005SANT/Myb domain
CDDcd001676.78E-91661No hitNo description
PROSITE profilePS5129426.64762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2665117IPR009057Homeodomain-like
SMARTSM007173.7E-1766114IPR001005SANT/Myb domain
PfamPF002492.2E-1667111IPR001005SANT/Myb domain
CDDcd001671.44E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009625Biological Processresponse to insect
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MVRTPCCRAE GLKKGAWTQE EDHKLIAYVE RHGEGGWRTL PDKAGLKRCG KSCRLRWANY  60
LRPDIKRGEF SQEEEDSIVR LHAIHGNKWS AIARRLPGRT DNEIKNHWNT HIKKRLVKKG  120
IDPLTHKSLN GKSSDHPETP PDKSSAHMEN DDQKSNKNNV LGSLSARFLN RVANRFGKRI  180
NHSVLSDIIG SGGPFNSHTT PTTSASECEK SSSLSSTPNS SDLFIDQNMI LDATSLSSST  240
FSSDISDPLS YDHIFDDIED MTPFSSRFLN DVISHDDEDF LTLDESCLEN TSFMRELTII  300
VQEDKIDTTA FRDSPVTSIS EVDDSFEGID NFFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6701200.0KJ670120.1 Brassica napus MYB transcription factor 122 (MYB122.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009128025.10.0PREDICTED: transcription factor MYB122-like
RefseqXP_013676724.10.0PREDICTED: transcription factor MYB122-like
SwissprotQ9C9C81e-167MY122_ARATH; Transcription factor MYB122
TrEMBLA0A078I6V70.0A0A078I6V7_BRANA; BnaC02g22630D protein
STRINGBra008131.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74080.11e-157myb domain protein 122